PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G075000.1
Common NamePOPTR_0017s11140g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 381aa    MW: 42705.4 Da    PI: 6.0825
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G075000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg WT+eEd +++ +v  +G g+W++++++ g++R++k+c++rw +yl
  Potri.017G075000.1 14 RGLWTPEEDAKILAYVSNHGIGNWTSVPKKAGLNRCGKSCRLRWTNYL 61
                        788*******************************************97 PP

2Myb_DNA-binding49.41e-1569110346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r+ +eE+el+++++k  G++ W++Ia++++ gRt++++k++w++
  Potri.017G075000.1  69 RFAPEEEELIIKLHKAIGSR-WSLIAKKLP-GRTDNDVKNYWNT 110
                         889*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-24563IPR009057Homeodomain-like
PROSITE profilePS5129425.781965IPR017930Myb domain
SuperFamilySSF466892.02E-3011108IPR009057Homeodomain-like
SMARTSM007177.4E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001673.13E-111761No hitNo description
Gene3DG3DSA:1.10.10.607.2E-2464116IPR009057Homeodomain-like
SMARTSM007172.1E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129417.87266116IPR017930Myb domain
PfamPF002499.4E-1469110IPR001005SANT/Myb domain
CDDcd001673.01E-1172112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKILAYVS NHGIGNWTSV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHERF APEEEELIIK LHKAIGSRWS LIAKKLPGRT DNDVKNYWNT KLRKMLQKMG  120
IDPVTHKPFS QIFSDFGNIS GISNTGNLNK SLNTSLMSEP DHQFSSAILT TPEHSCFKKT  180
MEEQVQEYNP TVTHPTSWDF LAQFPVHDTK QLPLFFNEVS SSCPSSTPSS SSTSTFTQSY  240
SCQKSQAPLI TPTCTFTCTE FLLSDPVSST EFQHQQEQYD FDEMFSPTNS STMAMAQNDV  300
SSCNITSTGS DDDWYLNRSV GRSTYDHGTV NNGLEENNNA ADHAAYYSSS ASSFVDGILD  360
KDRELHSQFP PLLDPSFDCY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141147106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324023.20.0hypothetical protein POPTR_0017s11140g
TrEMBLB9IJQ40.0B9IJQ4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s11140.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-83MYB family protein